PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.1398s0046.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family TALE
Protein Properties Length: 348aa    MW: 39350.7 Da    PI: 6.6595
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.1398s0046.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.87.5e-082863192154
                          HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          k +yp++e++++L +++gL+ +q+ +WF N+R +
  Cagra.1398s0046.1.p 286 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 319
                          469*****************************87 PP

2ELK29.12.2e-10240261122
                  ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                          ELKh+L+++Y+++++++++E++
  Cagra.1398s0046.1.p 240 ELKHELKQGYKEKIVDIREEIL 261
                          9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.1E-1975119IPR005540KNOX1
PfamPF037901.0E-1778118IPR005540KNOX1
SMARTSM012564.3E-28131186IPR005541KNOX2
PfamPF037911.4E-20136185IPR005541KNOX2
PROSITE profilePS512139.969240260IPR005539ELK domain
PfamPF037897.7E-7240261IPR005539ELK domain
SMARTSM011886.1E-4240261IPR005539ELK domain
PROSITE profilePS5007111.726260323IPR001356Homeobox domain
SMARTSM003892.4E-11262327IPR001356Homeobox domain
SuperFamilySSF466894.19E-16262326IPR009057Homeodomain-like
CDDcd000864.15E-11263324No hitNo description
Gene3DG3DSA:1.10.10.601.9E-25267324IPR009057Homeodomain-like
PfamPF059209.0E-18280319IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MAFHNNHFNH FTDQQQQHQP PPPPQQQQQH FHESAPPNWL LRSDNNFLNL QTSASAAATS  60
SDSPSSAAAN QWQNAKHKAE ILSHPLYEQL LSAHVACLRI ATPVDQLPRI DAQLAQSQNV  120
VAKYSTLDTA QGLLAGDDKE LDHFMTHYVL LLCSFKEQLQ QHVRVHAMEA VMACWEIEQS  180
LQSFTGVSPG EGTGATMSED EDEQVESDAH LFDGSLDGLG FGPLVPTESE RSLMERVRQE  240
LKHELKQGYK EKIVDIREEI LRKRRAGKLP GDTTSVLKAW WQSHSKWPYP TEEDKARLVQ  300
ETGLQLKQIN NWFINQRKRN WHSNPSSSTV SKNKRRSNAG ENSGRER*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A1e-12263328873Homeobox protein PKNOX1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankX923930.0X92393.1 A.thaliana mRNA for KNAT4 homeobox protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006287910.10.0hypothetical protein CARUB_v10001144mg
SwissprotP480010.0KNAT4_ARATH; Homeobox protein knotted-1-like 4
TrEMBLR0HAZ40.0R0HAZ4_9BRAS; Uncharacterized protein
STRINGBra006085.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44428158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11060.10.0KNOTTED1-like homeobox gene 4